Protein Info for Psyr_0194 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 197 (191 residues), 192 bits, E=1.7e-60
• PF08659: KR
  • amino acids 9 to 171 (163 residues), 59.4 bits, E=9.1e-20
• PF01370: Epimerase
  • amino acids 9 to 190 (182 residues), 28.2 bits, E=2.4e-10
• PF13561: adh_short_C2
  • amino acids 13 to 222 (210 residues), 139.7 bits, E=2.5e-44

Best Hits

Swiss-Prot: 47% identical to Y452_LISIN: Uncharacterized oxidoreductase Lin0452 (lin0452) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0194)

MetaCyc: 41% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

MetaCyc Pathways

• clavulanate biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See Q500A5 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Psyr_0194 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MSNIQGKVVLITGASSGIGEAAARLIAAKGAHVVLGARRSERLQTLAADIEAQGGSARFR
ALDVTDALDMQAFADFATHEFGKIDVIINNAGVMPLSPLAALKIAEWNQMLDVNVRGVLH
GIAAVLPSMQAQGHGQIINISSIGGLAVSPTAAVYCATKFAVRAISDGLRQETDKIRVTV
VCPGVVESELADSISDETAREAMKAFRKVALEPDAIARALVYAIEQPDGVDVSEIVVRPT
GSAY