Protein Info for Psyr_0170 in Pseudomonas syringae pv. syringae B728a

Annotation: heat shock protein Hsp15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF01479: S4" amino acids 11 to 56 (46 residues), 39.8 bits, see alignment E=3e-14 PF28601: HSP15_C" amino acids 91 to 133 (43 residues), 52.8 bits, see alignment E=2.9e-18

Best Hits

Swiss-Prot: 48% identical to HSLR_HAEIN: Heat shock protein 15 homolog (hslR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 100% identity to psb:Psyr_0170)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500C9 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Psyr_0170 heat shock protein Hsp15 (Pseudomonas syringae pv. syringae B728a)
MAQKMEEDDKVRLDKWLWAARFFKTRALAKAAIESGKVHCRGERCKPGKEPRVGDEFQIR
MGFDDRTVVVEALSIVRRGAPEAQTLYHETPESIARRENAAAQRKAGNLGVTTDGKPTKK
QRRELFGFRASQNND