Protein Info for Psyr_0159 in Pseudomonas syringae pv. syringae B728a

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR01428: haloacid dehalogenase, type II" amino acids 7 to 199 (193 residues), 163.6 bits, see alignment E=8.9e-52 PF00702: Hydrolase" amino acids 7 to 181 (175 residues), 37.7 bits, see alignment E=3e-13 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 9 to 182 (174 residues), 61.9 bits, see alignment E=1.4e-20 PF13419: HAD_2" amino acids 92 to 188 (97 residues), 26.1 bits, see alignment E=8.8e-10

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 99% identity to psp:PSPPH_5028)

Predicted SEED Role

"Haloacid dehalogenase, type II"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500E0 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Psyr_0159 HAD-superfamily hydrolase, subfamily IA, variant 2 (Pseudomonas syringae pv. syringae B728a)
MSFLRPKFITFDCYGTLTNFHMGTMTRELFADRVAAEQMDQFVKDFSAYRLDQVMGDWMP
YDEILKVALARTCKRWNVEYREEGQLYYDAVPTWGPHADVPAGLSKIADKIPLVIFSNAS
DSQIMSNVEKLGAPFHKVFTAEQAQAYKPRLAAFEFMLDNLGCGPEDILHVSSSFRYDLF
SAHDMKIRNKAFVARGHEQPANSSFEYHQIPDIGGLAGLVGL