Protein Info for Psyr_0143 in Pseudomonas syringae pv. syringae B728a

Annotation: chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details PF00015: MCPsignal" amino acids 304 to 471 (168 residues), 147 bits, see alignment E=2.6e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to psb:Psyr_0143)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500F6 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Psyr_0143 chemotaxis sensory transducer (Pseudomonas syringae pv. syringae B728a)
MDFKRMCSMPVAPRFLDHYRKADRIMLGLIWLLFIYALGLAFWFDTFTQAVVVGGGTAVV
LTGLYRAIGGTRLMRCCFGVGLMVMTALHINQTHGQVEIHFGIFVLLAVLTFYRDWLPIL
VAAVTIALHHIGFHALQHSGFPVYVMHHGFGWSMVLVHAVYVVVESAILVYLAVQNQAEA
VENQDMLDRMLATTNQFSTDGQSSQQSGKHVSLAQRFEQFLAQITGLVDGVVRDTRGLGE
LGHDLAKASGTLETGAQHQLSEIARMTGAMQRMGDAMNDISSHVAQAVQRAGDASDQVAH
GRDSVDRAQSEITQLAARITTTDETVQALANQSEQIGKVLDVIGSIAEQTNLLALNAAIE
AARAGEQGRGFAVVADEVRNLAQRTAASTKEIQTIIEDLQKGSRQAATAMSDSLQGVGRC
VEDSQRASQSLRAVGEGIGHITQLNGLIATTTEQQSAVSREMADQLRSVQTIAEHTAANI
GVLATSSQSLSPLAIRLEALGKSFHA