Protein Info for Psyr_0133 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13404: HTH_AsnC-type" amino acids 1 to 42 (42 residues), 61.4 bits, see alignment E=8.8e-21 PF13412: HTH_24" amino acids 1 to 47 (47 residues), 57.6 bits, see alignment E=1.1e-19 PF01037: AsnC_trans_reg" amino acids 64 to 146 (83 residues), 92 bits, see alignment E=2.5e-30

Best Hits

Swiss-Prot: 47% identical to DECR_ECO57: DNA-binding transcriptional activator DecR (decR) from Escherichia coli O157:H7

KEGG orthology group: K05800, Lrp/AsnC family transcriptional regulator (inferred from 99% identity to psp:PSPPH_5054)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500G6 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Psyr_0133 transcriptional regulator, AsnC family (Pseudomonas syringae pv. syringae B728a)
MDKFDRAILDILQTDCTRSVADIAERIGLGSTACWRRIQKLEEAGIIDRRVALLNPQRLN
VSVSVFAAIRTNQHNAAWLEQFHAAVGELPEVVECYRMAGDTDYMLRIVVAAIAGYDAVY
KQLISIPGISDVSSSFAMEQIKFTTGLPLQYASFGG