Protein Info for Psyr_0108 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 344 (317 residues), 76.7 bits, see alignment E=8.2e-26 amino acids 241 to 420 (180 residues), 48.6 bits, see alignment E=2.8e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0108)

Predicted SEED Role

"Ribitol/Xylitol/Arabitol transporter, MFS superfamily" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500J0 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psyr_0108 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MSDQSTPNTPLVRFCDKVGIPYPMFWGFVGLLIFMIGDGVELGYLSPFLSERGMPGDEVA
MIFTLYGVTVGISSWLAGALSNIWGPKRVMFLGLIIWSVFEVLFLVYGLQELSYSMILLT
YGLRGFGYPLFAYGFLVWIAASTPSRKMGMAVGWFWVAYAAGLPMLGSLVASIAIPLIGA
LLTFWLSFALVVIGGVIGLVGMREAHGMRRLAPEGERPLVSMAKNITIMWTRPKVSLAGI
VRVINTSSMFGFLVVMPGFFMQTVGFTLEEWLRLLTIVFVFNIIGNLGSSVISTKIGYRN
TILWFGAVGSTISTPLFFFMPQAFPNDFLIASIFGAFYGLTLACFVPLSALAPALAPNNK
AAALSVLSLGAGASTWVGPAVVAIFNESYGIEGVVWAFSGLYALSAVLTVFLKDPEPVHD
PILIKIKRRIKVFAPRLDYRWAHAEDPKQGQS