Protein Info for Psyr_0096 in Pseudomonas syringae pv. syringae B728a

Annotation: transposase, IS4 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF05598: DUF772" amino acids 18 to 109 (92 residues), 82.5 bits, see alignment E=2.6e-27 PF01609: DDE_Tnp_1" amino acids 136 to 311 (176 residues), 134.7 bits, see alignment E=3.7e-43

Best Hits

Swiss-Prot: 55% identical to INSH6_ECOLI: Transposase InsH for insertion sequence element IS5H (insH6) from Escherichia coli (strain K12)

KEGG orthology group: K07481, transposase, IS5 family (inferred from 100% identity to psb:Psyr_0096)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500K2 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Psyr_0096 transposase, IS4 family (Pseudomonas syringae pv. syringae B728a)
MMKQMTFADAEYAGKRKRTRKELFLIEMDQVVPWKGLIALIEPYYPKGEGGRPAYPLMAM
LRVHLMQNWFGYSDPAMEEALYETTILRQFSGLSLERIPDETTILNFRRLLEKHELATGI
LGVINGYLGDRGLSLRQGTIVDATLIHAPSSTKNKDGKRDPEMHQTKKGNQYYFGAKAHI
GADDESGLVHSVVVTAANVADVTQVAKLLHGEENVVCADAGYTGVEKREEHTGRKVIWQI
AARRSTYKKHGKRNVLYKAIRKIEKAKAQVRAKVEHPFRVIKRQFGYEKVRFRGLAKNTA
QMVTLFALSNLWMARRHLLASAGEVRV