Protein Info for Psyr_0080 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF81

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 7 to 36 (30 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 156 to 182 (27 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details PF01925: TauE" amino acids 10 to 263 (254 residues), 147.9 bits, see alignment E=2.1e-47

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to psb:Psyr_0080)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500L8 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Psyr_0080 Protein of unknown function DUF81 (Pseudomonas syringae pv. syringae B728a)
MDEHQLLGVGLGTVIGMVLALTGAGGGILAVPLLVFGLGLSIVEAAPVGLLAVGLAAGIG
AVLGLRQGIVRYRAAGYIASIGVLMAPLGLWLAHRLPNTPLALVFSAVLLYACGRMFIRA
SRELRHEKPAPRAEILPCVLNPLQGRLRWTMPCLRALTLTGVGSGLLSGLLGVGGGFVII
PALTRYSDLDMKSVVATSLAVIALVSMGSVITASLSGVMHWAVGAPFALGAVIGLIIGRQ
VARYLAGPRLQQLFAVCGIVAAFMLALSVR