Protein Info for Psyr_0079 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 9 to 121 (113 residues), 28.7 bits, E=9.1e-11
• PF13454: NAD_binding_9
  • amino acids 12 to 42 (31 residues), 22.4 bits, see alignment (E = 1.1e-08)

Best Hits

Swiss-Prot: 38% identical to SQOR_HUMAN: Sulfide:quinone oxidoreductase, mitochondrial (SQOR) from Homo sapiens

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0079)

MetaCyc: 75% identical to sulfide:quinone oxidoreductase (Pseudomonas putida KT2440)
R17-RXN [EC: 1.8.5.4]

Predicted SEED Role

"FIG002984: FAD-dependent pyridine nucleotide-disulphide oxidoreductase"

MetaCyc Pathways

• sulfide oxidation I (to sulfur globules) (1/1 steps found)
• sulfide oxidation III (to sulfite) (3/4 steps found)
• superpathway of sulfide oxidation (Starkeya novella) (3/5 steps found)
• superpathway of sulfide oxidation (Acidithiobacillus ferrooxidans) (6/10 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.4

Sequence Analysis Tools

See Q500L9 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Psyr_0079 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MNASTTTCQILIVGAGAAGIATAASLLARDATLQITLVDPADTHYYQPGWTMVGAGIFTP
QSTARSMASLIPEGVQWIKAAVATFEPQHNTLTLADGRVLGYQQLVVCPGLKLDWSAIDG
LVDTLGANGVTSNYRYDLAPYTWKLVQNLQQGRALFTQPPMPIKCAGAPQKAMYLSCDHW
LKSGRLAQINTQFYNAGGVLFGVADYVPALMKYVERYAIDLKFSHRLVAVDGPGKRATFI
RTQADGSSETVEQSFEMLHVVPPQIAPDFIRSSPLADAAGWVDVDPATLKHRQFANVHGL
GDATNTSNAKTAAAARKQAPVVANNVLVALGRRSESAVYDGYGSCPLTVEKGRIVLAEFT
YGGKVAPSFPRWLLDGRQPTRLAWWLKARVLPALYWHGMLKGREWLAKPQKADTRHG