Protein Info for Psyr_0078 in Pseudomonas syringae pv. syringae B728a

Annotation: Beta-lactamase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF00753: Lactamase_B" amino acids 22 to 212 (191 residues), 75 bits, see alignment E=8e-25 PF12706: Lactamase_B_2" amino acids 34 to 177 (144 residues), 28.4 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 68% identical to Y2304_BURP1: Probable metallo-hydrolase BURPS1710b_2304 (BURPS1710b_2304) from Burkholderia pseudomallei (strain 1710b)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0078)

Predicted SEED Role

"FIG146518: Zn-dependent hydrolases, including glyoxylases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500M0 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Psyr_0078 Beta-lactamase-like protein (Pseudomonas syringae pv. syringae B728a)
MIIGEKLHVEALFDTHTWTISYLVMDLHSKQCALIDSVLDYDPKSGRTRTESADRMIERA
QALGASVQWIFETHVHADHLSAAPYLKQRLGGQIVIGSHITAVQETFGTLFNAPPDFARN
GSQFDVLLEDNASFALGALEVKAMHTPGHTPACMSYLVQVGDATVAFVGDTLFMPDYGTA
RCDFPGADARTLYRSIKKLLALPPETLLFMCHDYLPNGRELKYMTTVAEQRASNIHVHDG
VDEDAFVGMREARDATLDMPVLMLPAVQVNMRCGHFPEPEDNGVVYLKIPLNAL