Protein Info for Psyr_0073 in Pseudomonas syringae pv. syringae B728a

Annotation: Multi antimicrobial extrusion protein MatE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 241 to 266 (26 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 18 to 423 (406 residues), 228.8 bits, see alignment E=5.5e-72 PF01554: MatE" amino acids 18 to 176 (159 residues), 91.2 bits, see alignment E=3.1e-30 amino acids 244 to 410 (167 residues), 81.8 bits, see alignment E=2.4e-27

Best Hits

Swiss-Prot: 91% identical to NORM_PSESM: Probable multidrug resistance protein NorM (norM) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 100% identity to psb:Psyr_0073)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500M5 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Psyr_0073 Multi antimicrobial extrusion protein MatE (Pseudomonas syringae pv. syringae B728a)
MQHSALKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEALAGGGLGAATYSFVSF
FCVGVMAAVGTLVSIRHGAGDTEGATRLTQAGLWLAWGMALVAALLLWNLEPILLQFGQA
EANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPVMTISLAGAAANFVLNYALIH
QWLGLPNLGLMGIGLVTAIVTNCMALALALHIRLHPAYAAYPIRKGLSKLSRSHLGELWR
LGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTVSMAFMVPVGMSYAVTMRIG
QHYGAGNLLMVRMAGRLGIGFGGCVMLMFGLLFWLAPHLVIGLFLDINDPAFAEIVVLAT
KLLAIAALFEFFDGTQTIAMGAIRGLKDARTTFLIGLGCYWLIAAPAAWLLGFSTDAGAS
GVWWGLALGLFCSAVALTYAFEWKTARLLRQDAAGLPVPG