Protein Info for Psyr_0067 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details PF19346: DUF5924" amino acids 3 to 259 (257 residues), 379.8 bits, see alignment E=5.8e-118 PF11141: DUF2914" amino acids 270 to 335 (66 residues), 77.4 bits, see alignment E=5.7e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0067)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500N1 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Psyr_0067 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MLDVNRYVTPVLNLMQRYPGLIAAFGFVSGIASFILVDRQAGLATWIAVVMLISWLWLMV
ENTMVGLLNKALGREIPQGLLRYGTQMIHQESLFFVLPFFFITTTWNSGQAVFTAVLGAA
GLISIIDPLYYKWLAPRRWLFMTLHTLTLFAALLTALPIILHLTTAESYKLALGVAMLLS
APSLMSNFPLNTWRSALAVISIILAIGAAGWLLRSWVPPATLWLTEVAVSPDFDNKNRTP
GDSISLISARQLRNGGLYAYTAINAPRGLDERIYHVWWHEGEEMDRIALDIHGGRKEGYR
AWTRKQNFPEDVTGRWQVRVLTEDGQMIGVLRFVVTDDDQPAVKRPTGRIIKLKPGGDSA
EEATPESAPATEPKQEKQEAAPAEPAPAESAPQVPAQ