Protein Info for Psyr_0065 in Pseudomonas syringae pv. syringae B728a

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR00838: argininosuccinate lyase" amino acids 10 to 456 (447 residues), 639.1 bits, see alignment E=2.3e-196 PF00206: Lyase_1" amino acids 12 to 306 (295 residues), 262.6 bits, see alignment E=5.8e-82 PF14698: ASL_C2" amino acids 369 to 437 (69 residues), 99.7 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to ARLY_PSEU2: Argininosuccinate lyase (argH) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 100% identity to psb:Psyr_0065)

MetaCyc: 51% identical to argininosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500N3 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Psyr_0065 argininosuccinate lyase (Pseudomonas syringae pv. syringae B728a)
MSTDKTNQSWGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIAHATMLAKVGVLTDAE
RDTIVDGLNTIQAEIEAGQFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVAT
DIRLWLRDEIDLILSEITRLQQGLLGQAEREAETIMPGFTHLQTAQPVTFGHHMLAWFEM
LSRDYERLVDCRKRLNRMPLGSAALAGTTYPIDRELTCTLLGFEVVGGNSLDGVSDRDFA
IEFCSAASIAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTGSSIMPQKKNPDVPELVRGK
SGRVFGALMGLLTLMKGQPLAYNKDNQEDKEPLFDAADTLRDSLRAFADMIPAIKPRHAM
MREAALRGFSTATDLADYLVRRGLPFRDCHEIVGHAVKYGVETGKDLAEMSLEELRQFSN
QIEQDVFAVLTLEGSVNARNHIGGTAPEQVRAAVIRGQELLAGR