Protein Info for Psyr_0061 in Pseudomonas syringae pv. syringae B728a

Annotation: uroporphyrinogen-III synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF02602: HEM4" amino acids 17 to 233 (217 residues), 99.2 bits, see alignment E=1e-32

Best Hits

Swiss-Prot: 65% identical to HEM4_PSEAE: Uroporphyrinogen-III synthase (hemD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01719, uroporphyrinogen-III synthase [EC: 4.2.1.75] (inferred from 100% identity to psb:Psyr_0061)

Predicted SEED Role

"Uroporphyrinogen-III synthase (EC 4.2.1.75)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.75

Use Curated BLAST to search for 4.2.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500N7 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Psyr_0061 uroporphyrinogen-III synthase (Pseudomonas syringae pv. syringae B728a)
MSGWRLLLTRPAEESAALARVLAEAGIFSSSLPLLETEPLPLTPAQRSIIFELLNYCAVI
VVSKPAARLAIELIDEVWPQPPLQPWFSVGSATGQILVDYGLDASWPEQGDDSEALLELP
RLKQAIAVPGSRVLIMRGDEGRELLAEQLRALGVGVDYLPLYRRYLPQHAPGALAQRVAV
ERLNGLVVSSGQGFEHLLQLAGDSWPDLADLPLFVPSPRVASIARAAGARTVIDCRGASA
TALLAALREQPQPAVKA