Protein Info for Psyr_0056 in Pseudomonas syringae pv. syringae B728a

Annotation: Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF04353: Rsd_AlgQ" amino acids 10 to 155 (146 residues), 172.2 bits, see alignment E=3.7e-55

Best Hits

Swiss-Prot: 64% identical to ALGQ_PSEAE: Transcriptional regulatory protein AlgQ (algQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07740, regulator of sigma D (inferred from 100% identity to psb:Psyr_0056)

Predicted SEED Role

"Regulator of sigma D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500P2 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Psyr_0056 Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ (Pseudomonas syringae pv. syringae B728a)
MPLKGREKTMLESCQNAQERWGGVNKLIDRWLQSRLKLVEAYDALGDTPAALAADREGLQ
NFCGILVDYVSAGHFEVYEQLGDEARAFNDKRGLELADTIYPRLDFITKFALTFNDRCDK
GDCSDATAVAREFNQLGQLLHERFELEDCLIEVLHNSHKEEIAAQV