Protein Info for Pf6N2E2_992 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 68 to 330 (263 residues), 95.9 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 31% identical to ARAH_SHIFL: L-arabinose transport system permease protein AraH (araH) from Shigella flexneri

KEGG orthology group: None (inferred from 50% identity to bam:Bamb_3330)

MetaCyc: 31% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUN6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Pf6N2E2_992 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1) (Pseudomonas fluorescens FW300-N2E2)
MRQARETSHLASSTPSRTKTMTSAVGDFVRDSVQADRIQVNGIKVVSILLIIWGHLSVDN
FLTPANLNAIMYSVSAIGIAAVGMAFITLSGNLFMLSMAATAALSTIVFASTLHFGLPVA
LLSVSVLGIAIGSIQGVVVGTARVNPIIATIAVASIVMGVGSYVSGGMTVVGKGDASWLG
IGKFASLVPNQLVIFLAFSLAANYWVERTRFGRELRLIGLNPVTAAYSGIRVPRTLVIAF
VIAGFSAALAGGLFASQAGQGNLKLAAGLDFDAIAAVLVAGISIRGGQGKIIDAVYGAIF
LALIGNLLLVHGLSFEIQLMVKGAVVVLAVILAALIARGRVH