Protein Info for Pf6N2E2_978 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein with ParB-like nuclease domain in PFGI-1-like cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 TIGR03764: integrating conjugative element, PFGI_1 class, ParB family protein" amino acids 27 to 282 (256 residues), 378.7 bits, see alignment E=8e-118

Best Hits

KEGG orthology group: None (inferred from 83% identity to pfs:PFLU1978)

Predicted SEED Role

"Protein with ParB-like nuclease domain in PFGI-1-like cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YXX8 at UniProt or InterPro

Protein Sequence (527 amino acids)

>Pf6N2E2_978 Protein with ParB-like nuclease domain in PFGI-1-like cluster (Pseudomonas fluorescens FW300-N2E2)
MKKLTQEEITEKLHQDHFPRGPELGRLSDPLTDTPMLVTLEQLRPYEHNPRFIRNPLYDD
IKASIRERGLDQPPPITRRPGEAYFIIRNGGNTRLAILGELWQETRDESFFRINCLFRPW
TDEISALLGHLAESDLHGQLTFIERALAVTKLKTMLELDGATLSQRELARRLAAGGYPIS
QSHISRMLDTLEHLLPAIPQTLYAGLGKPKIERLIGLRSQAERTWNRYLTDTIAFPELWL
DTLGQFDADPESFDLEQIQDELLERMSRLLGQSYRMLALELGDTQRVIQTPGVVVTPPQN
NLLPSVDEPAAEPPPSEPQPKSAENWTQTETEREEQLTLPVTNVVSAVSPPSRVQQIRGQ
IDRATASEPTKTVVTCPIDDIWIIAPTLDTPEQLRLAIAGLAREMAAYAGRPESIIDQKH
GLGFALSIEQLDLAAPRAAGVHLLLLALLRAQDEVNWEDRKQLPSALFGQLLLGVYQLPL
ADRPAVDVGLERLPDSLLIKLYRLIRLARRLIDLTLTHEDDSTKELP