Protein Info for Pf6N2E2_97 in Pseudomonas fluorescens FW300-N2E2

Annotation: putataive branched-chain amino acid transport protein AzlC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 217 to 233 (17 residues), see Phobius details PF03591: AzlC" amino acids 25 to 164 (140 residues), 124.5 bits, see alignment E=2.2e-40

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3773)

Predicted SEED Role

"putataive branched-chain amino acid transport protein AzlC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YJ26 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Pf6N2E2_97 putataive branched-chain amino acid transport protein AzlC (Pseudomonas fluorescens FW300-N2E2)
LSNVEPQLHALTLNHIYDGFKQLIPISLFVVVFGVAFGLAAAQTGLSDTSAVLMSTLVFA
GASQFAALDLWGQQVPVVPLMITVFAINARHLLMGATLYPWLRELPVAKRYGVMLVVSDA
NWAMAMQALSRGKPGLGLLFGGGIALWVAWILGSWLGLHFGSAIENPVSFGLDMVMGCFL
LAMVVGGKKNLRMFIIWTVAACSSLLAYWYLPANSHVVVGALAGGILGALWMEKTQ