Protein Info for Pf6N2E2_967 in Pseudomonas fluorescens FW300-N2E2

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR00608: DNA repair protein RadC" amino acids 28 to 164 (137 residues), 137 bits, see alignment E=4.1e-44 PF04002: RadC" amino acids 43 to 163 (121 residues), 145.1 bits, see alignment E=4.9e-47

Best Hits

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 90% identity to pfo:Pfl01_3005)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YXV4 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Pf6N2E2_967 DNA repair protein RadC (Pseudomonas fluorescens FW300-N2E2)
MSTQLTLIETSDVEGDRIAQENQLIDEALRILDRRLFTRGPNLTSPDAVGSYLKLHLAPQ
EHEVFGVIFLDARHRVLAFEILFHGSIDGASVYPRQVVKRSLAHNAAAAIVCHNHPSGCT
EPSLADRALTARLKEALDLIEVRVLDHFIVGEGRPLSLAEHGWL