Protein Info for Pf6N2E2_963 in Pseudomonas fluorescens FW300-N2E2

Annotation: probable exported protein STY4558

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR03759: integrating conjugative element protein, PFL_4693 family" amino acids 22 to 215 (194 residues), 260.8 bits, see alignment E=3.3e-82

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfs:PFLU1964)

Predicted SEED Role

"probable exported protein STY4558"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUK5 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Pf6N2E2_963 probable exported protein STY4558 (Pseudomonas fluorescens FW300-N2E2)
MGNPVTTPSRVQDTQSTPLGRSHSKQAASWGLTEQEWTRFEQIQAGPRGFWSPNIDPLTA
LGVEAETDQERQRYAELQVVLEAKRAERELAYQNAYTAAWAKLFPGLLPIQGMASPPTAS
SPVEPRRALFVEDHCPACTAEAQRLQSSNTAFDIYLVSSQGEDERVRRWARQADIDPAKV
QRQQITLNHDRGRWFSLGAAGPLPATFQQVNGQWQRLD