Protein Info for Pf6N2E2_947 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multidrug efflux membrane fusion protein MexE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 368 (331 residues), 252.7 bits, see alignment E=2.2e-79 PF25917: BSH_RND" amino acids 62 to 198 (137 residues), 72 bits, see alignment E=8.7e-24 PF25876: HH_MFP_RND" amino acids 105 to 172 (68 residues), 39.4 bits, see alignment E=1.8e-13 PF25944: Beta-barrel_RND" amino acids 230 to 291 (62 residues), 32.9 bits, see alignment E=2.2e-11 PF25967: RND-MFP_C" amino acids 301 to 359 (59 residues), 34.1 bits, see alignment E=6.4e-12

Best Hits

KEGG orthology group: None (inferred from 76% identity to pen:PSEEN2313)

Predicted SEED Role

"Multidrug efflux membrane fusion protein MexE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWD4 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Pf6N2E2_947 Multidrug efflux membrane fusion protein MexE (Pseudomonas fluorescens FW300-N2E2)
MEQSLKPLRYPLAALALVVLTACERTPNAAQAPGAPHVTVAKVLEQPITEWDEVTARLEA
PETVEVRPRVTGQIDRVAFNDGALVKKGDLLFQIDPRPFEHEVHRIEAQLQQARATLVRT
GNEAQRGQRLLSSNAISAELADTRTTTAQEARAGVDAIQAQLDLARLNLSFTRVTAPITG
RVSRAEITAGNIVTADTTPLTSVVSTDKVYAYFDADERMFLKYSLLSRQGQRGQATPVYM
GLSNEEGNSHLGQMNFVDNQVNPKTGTIRGRAVFDNADGQYTPGLYARLKLVGSAAYPGL
LIKDEAVGTDLGKKFVLVVDQDNKAVYRSVDLGPKLEGLRIVRSGLQKDDRIVINGLQRV
RPGAVISPEDAPMASPEVVSILEQKRQAIEASHQPVSTQSPALAAAAPRG