Protein Info for Pf6N2E2_944 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF02630: SCO1-SenC" amino acids 1 to 107 (107 residues), 101.3 bits, see alignment E=2.2e-33

Best Hits

KEGG orthology group: None (inferred from 48% identity to isc:IscW_ISCW024476)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>Pf6N2E2_944 Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone (Pseudomonas fluorescens FW300-N2E2)
MVIFGFTKSPSIVPTALARAVEIKKMMGKDGERFQVIFVTLDPERDTPAILDAYVKSFDP
SFVALYGTPKETAATAKEFNVAYEKIPSGSTYTLSHSTTSYVYDYRGTLRLGLSQSLSAQ
ECAEDLLNLMEICE