Protein Info for Pf6N2E2_932 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 181 to 199 (19 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 77 to 253 (177 residues), 59.5 bits, see alignment E=5.5e-20 PF12833: HTH_18" amino acids 315 to 392 (78 residues), 63.7 bits, see alignment E=2.4e-21

Best Hits

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZSN6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Pf6N2E2_932 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain (Pseudomonas fluorescens FW300-N2E2)
VPNISVLRVYLRAHEWQVRRGNARGSEFQSKLFGRSTSDRSKTISATNVHSKPGRTGPPP
MRKFTKPAAPPANMRQKRIVILGLPPVDALDVIGPAEVFAWANQLDRGGLAPYLLELVSS
AADVHLESETGIALRGHSTLEQERRANKPIDTLLVTMGSRSFEQIDQEAIEWLRARSKTV
RRVCSICVGAFALAAAGLLDGRRATTHWSVARRLAERYPKVQVDPSPIWVKDGNVYTSAG
ISSGIDLALSLVSEDLGNDFAMEIAKNLVLYLHRPGGQAQFSFALQSQHAHNSSLSELCL
WISEHLHMDLTVEIMAARVSTSVRTLIRMFQRELQTTPAKYVENVRLEAVCRSLALGEKS
MHDISRRNGYHSVDVLRRVFTRRFGLSPMEYSHHFGKGTEPTESG