Protein Info for Pf6N2E2_916 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 452 to 476 (25 residues), see Phobius details PF07916: TraG_N" amino acids 10 to 493 (484 residues), 240 bits, see alignment E=2.7e-75

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU1920)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YXE6 at UniProt or InterPro

Protein Sequence (512 amino acids)

>Pf6N2E2_916 putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
MLMSTNSYLEFYLSLLAWIINNGLWSVLSDTGLFAAPFGAIILQEWLSARQQGADEGNKG
LLSVPRIENRLWLAYIVVLFGCAPVFPLSLSSMTFDDAASQHCGVSVAKPTETAWGATFN
TIGERSANVPIWWFLVHALSKGVTAAATASIPCAPDIRQMRMEIDSSRIDSQVLLQEVAD
FTRDCYGYSRSRLFTNRPQLDKAQSHDASWIGSSYLLDTPGYYDTDRSRTPRVSWPYDES
RDVSLPRLENGAGYPTCKQWWSDSGVGLRERLIQQVDPSLLTQLKGWLTGRSSNEIEDAT
LRELVSPRQQSMSMSPGQVYQDYGSSARGGSINQGLNNLATNTGLALGSFSNFPAMNALR
AALPMVQAFLIMGVIISLPLILLVSTYQLKTVMTVTFALFTLHMLSFWWELARWVDSSLL
DTLYNQVSASNQVLLSLPTSGFMDGTVTAQVIEYVMGAMFLVLPGLFLVTMSWAGYSIGN
SLEGMLGGASKAAHGAAGKGTDQLMGATKKLI