Protein Info for Pf6N2E2_885 in Pseudomonas fluorescens FW300-N2E2

Annotation: Myo-inositol 2-dehydrogenase (EC 1.1.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF01408: GFO_IDH_MocA" amino acids 3 to 121 (119 residues), 84.3 bits, see alignment E=1.6e-27 PF22725: GFO_IDH_MocA_C3" amino acids 132 to 245 (114 residues), 57.3 bits, see alignment E=2.5e-19 PF02894: GFO_IDH_MocA_C" amino acids 136 to 323 (188 residues), 45.9 bits, see alignment E=9.5e-16

Best Hits

Swiss-Prot: 39% identical to IOLG_STRAW: Inositol 2-dehydrogenase (iolG) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: K00010, myo-inositol 2-dehydrogenase [EC: 1.1.1.18] (inferred from 71% identity to ara:Arad_0116)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YX79 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Pf6N2E2_885 Myo-inositol 2-dehydrogenase (EC 1.1.1.18) (Pseudomonas fluorescens FW300-N2E2)
MSIRIAVIGAGIMGEDHARIIAQDLPGATLHVVCDASPERAKLIADRYGAADVSTDPLFT
LSRSDVDAIIIASPDETHAVLTMAAIEAGKPALCEKPLSQSPDQCLAVIDKEASRGRQFV
QLGFMRRFDPSYREMKSALSDGVIGRAVMMHNFHRNVEAPANFSGQMAISNSAPHEFDVA
RHVLDTEYVAISVFQPTHTSEDGVGAPVFMVLETREGHLVNIEINNNAHYGYDVRGELVG
ERGSVQLNTPVHTRFNTCLQGFERYAADWRPRFADAYRLQNKAFVAFINTGRFPVHAANA
WDGYCAAIVAQAGIEALNQRRRVVLPTLEAPPLYRSREGATS