Protein Info for Pf6N2E2_877 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cobalt-containing nitrile hydratase subunit alpha (EC 4.2.1.84)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF02979: NHase_alpha" amino acids 20 to 200 (181 residues), 299.8 bits, see alignment E=2.9e-94 TIGR01323: nitrile hydratase, alpha subunit" amino acids 20 to 206 (187 residues), 313.4 bits, see alignment E=4.5e-98

Best Hits

Swiss-Prot: 78% identical to NHAA_PSEPU: Nitrile hydratase subunit alpha (nthA) from Pseudomonas putida

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 84% identity to kva:Kvar_2628)

MetaCyc: 58% identical to nitrile hydratase alpha subunit (Rhodococcus rhodochrous)
Nitrile hydratase. [EC: 4.2.1.84]

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit alpha (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUD8 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Pf6N2E2_877 Cobalt-containing nitrile hydratase subunit alpha (EC 4.2.1.84) (Pseudomonas fluorescens FW300-N2E2)
MSHTHEHHHDHDHTEPPEAIALRVKALESLLIEKGLVDPTAMDALVDTYQHKVGPRNGAQ
VVAKAWFDPDYKHRLLEDATAAIAELGFSGVQGEDMVVVENTATVHNVTVCTLCSCYPWP
TLGLPPVWYKSAPYRSRIVIDPRSVLAEFGLTIPNDKEVRVWDSSAELRYLVLPERPVGT
DGWSEERLVELVTRDAMIGTGLPKMPGDEA