Protein Info for Pf6N2E2_871 in Pseudomonas fluorescens FW300-N2E2

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 174 to 194 (21 residues), see Phobius details PF00672: HAMP" amino acids 194 to 241 (48 residues), 35.2 bits, see alignment 1.9e-12 PF00512: HisKA" amino acids 248 to 304 (57 residues), 36.7 bits, see alignment 5.2e-13 PF02518: HATPase_c" amino acids 346 to 453 (108 residues), 73.8 bits, see alignment E=2.3e-24

Best Hits

KEGG orthology group: None (inferred from 74% identity to pfs:PFLU3642)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GMH9 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Pf6N2E2_871 sensor histidine kinase (Pseudomonas fluorescens FW300-N2E2)
MNRLRVLWPRKMVHQLSVLLLLALLASNAIAMLVLQRTGALIHPLSRTMSLERLVTAHHA
ALEAPNQVGARLLASMITPDAHFWIDRRADVEPFDMRAEEQRLANVLRERLQLAPDLAVV
MQLERVTGGHARDQVFSPAGWAPLRLRSSIELPDGRYLNALQHPVGAYEWRKVLTYSLPV
TIIPVLLIVMFCISRVVQPVKTLVQASERVSRGEWIAPLPLTGPQEARDLTAAFNHMQAS
IARHVEGRTRMLAAISHDLNTPITELRLQVELLEEGDAREDMLESLEELSLMVRETLNFV
REDAVQEPTLTISLNGLLDDLAKRYQLLNQPVTWHGAPPIMLTCRPLALKRALTNLIDNA
LRHAGDATLSLCREDAGTVRLDILDHGAGLPDAWLSRVFEPFVQFAGGTADGHKGGVGLG
LAIARACVQAHGGELLLENRPSAGLCAVVRLPAALLRSSA