Protein Info for Pf6N2E2_837 in Pseudomonas fluorescens FW300-N2E2

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 22 to 439 (418 residues), 352.4 bits, see alignment E=1.9e-109 PF00529: CusB_dom_1" amino acids 54 to 397 (344 residues), 26.2 bits, see alignment E=1.2e-09 PF13533: Biotin_lipoyl_2" amino acids 70 to 97 (28 residues), 30.9 bits, see alignment (E = 3.6e-11) PF13437: HlyD_3" amino acids 292 to 393 (102 residues), 44.4 bits, see alignment E=4.9e-15

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 63% identity to pmy:Pmen_0719)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUW0 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Pf6N2E2_837 HlyD family secretion protein (Pseudomonas fluorescens FW300-N2E2)
MSDFMQNSKHSSTALLVDDTPVRRVGYLMLLVTFGLFGGWAALAPLDSSALAPGVVTVKS
YRKTVQHLEGGIVRELRVHDGDLVKTGDVLLVLDNTQARSEMETTRSQLIAALQLQARLE
AERDALPEPLAVPALDPADPRVQEARDSEARIFQTRRTSLLGEIGLQEKTIGQIEEQIRG
FKAIIASKQALAASYQEEIVDLRALLAEGYVDKQRLREQERSLSRLQTEIAESQSEIAQA
HVHIDEARLKILQLKKTFASEVAGLLGDARTKVYELRERLATLQDRDQRTDILAPESGMV
MGMTVHTLGAVVSPGTALLDIVPANEELIIEAQVSPMDIDRIALGKLADIRFSAFKSSTT
PVIEGQLVQISADRLINKDTGTAYYLARVALTDKGRQALGNLTLVPGMPVEVLVNTGART
LLQYLIQPASNVFARSLIED