Protein Info for Pf6N2E2_830 in Pseudomonas fluorescens FW300-N2E2

Annotation: Long-chain fatty acid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03349: Toluene_X" amino acids 14 to 423 (410 residues), 395.3 bits, see alignment E=2.7e-122 PF02530: Porin_2" amino acids 204 to 415 (212 residues), 31.6 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 86% identity to pba:PSEBR_a3067)

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTT8 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Pf6N2E2_830 Long-chain fatty acid transport protein (Pseudomonas fluorescens FW300-N2E2)
MKRILLKTPMSLAVALATSQVFASGFALNEQSISGMGAGFAGRSSSAEDASTVFGNPAGM
SRLKKEQVSLGAATLFTQSDISQTRSTFGGREDGDMVPTTTVPMGYYVKPVDEHWAVGVG
FYVPFGLITDYGSDFAGRYYGNKSEVTTLTFQPTVSYAFNDKVSIGFGPTINRISGEISG
MVPNPLSPGSNDGKLKSNGDDTALGFNAGILVQATDQTRLGLTYHSKVSYHLDAKSKLTG
GIFSVLGVSGRSYDASLDVDTPESVDISLTHQLNDDWTMYLGSTWTRWSRFKELTIENSG
LPALLSGTLGTVSEEQNWHDTWAHAIGAAYKLNDQWVLRAGLSVDQSPANNTNRGPRIPT
GDRTVLSFGAGWTPVEEVTIDVAYSYLQEESVRINETSSTRGAYSSKYRNSASGFGTSVS
YRF