Protein Info for Pf6N2E2_809 in Pseudomonas fluorescens FW300-N2E2

Annotation: Various polyols ABC transporter, permease component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 29 to 53 (25 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 306 (202 residues), 57.8 bits, see alignment E=6.3e-20

Best Hits

Swiss-Prot: 36% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 99% identity to pba:PSEBR_a3087)

MetaCyc: 92% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X593 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Pf6N2E2_809 Various polyols ABC transporter, permease component 1 (Pseudomonas fluorescens FW300-N2E2)
MNSSTTTAKAPIEIAPPPARKIRLANPGWFLVSPSVALLLLWMIVPLGMTVYFSMIRYNL
LYPGENEFVGLENFTYFLTDSGFMPGATNTLLLVGSVLLISIVLGVLISALLEASEFFGR
GIVRVLLISPFFIMPTVGALIWKNLIFHPVSGILASVWKLFGAQPVDWLAHYPLLSIIII
VSWQWLPFAILILMTAMQSLDQEQKEAARLDGAGPIAIFWHLTLPHLARPIAVVLMIETI
FLLSVFAEIFTTTNGGPGYASTNLAYLIYNQALVQFDVGMASAGGLIAVVIANIAAIILV
RMIGKNLTDKH