Protein Info for Pf6N2E2_802 in Pseudomonas fluorescens FW300-N2E2

Annotation: Threonine dehydratase biosynthetic (EC 4.3.1.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 181 to 199 (19 residues), see Phobius details TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 14 to 332 (319 residues), 495 bits, see alignment E=1.2e-152 PF00291: PALP" amino acids 28 to 314 (287 residues), 272.5 bits, see alignment E=2.4e-85

Best Hits

Swiss-Prot: 39% identical to Y4TJ_SINFN: Putative threonine dehydratase (NGR_a01490) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 97% identity to pba:PSEBR_a3094)

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>Pf6N2E2_802 Threonine dehydratase biosynthetic (EC 4.3.1.19) (Pseudomonas fluorescens FW300-N2E2)
MTVTRTEQTLLEHYVKKILAAPVYELAVRTPLQAAPALSEALGNRILLKREDLQPTFSFK
IRGAYNKLVQLTPEQRARGVITASAGNHAQGVALAARELGISASIVMPVTTPQLKVLGVR
NRGAEAILHGESFPFALAHALELAEQSGWEFVSPFDDPDVIAGQGTVAMEILRQHPGQLD
AIFVPVGGGGLIAGIAAYVKYLRPEVRIIGVESQHSACLQAALAAGERVTLPEVGTFADG
VAVAQIGAHGLDICRFCVDEVMTVSNDQLCAAIKDIYDDTRSITEPSGALAVAGIKQYVA
GTGARGQTLVAIDSGANINFDSLRHVAERAAVSAF