Protein Info for Pf6N2E2_801 in Pseudomonas fluorescens FW300-N2E2

Annotation: Soluble aldose sugar dehydrogenase, PQQ-dependent (EC 1.1.5.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07995: GSDH" amino acids 46 to 378 (333 residues), 465.8 bits, see alignment E=4.6e-144

Best Hits

Swiss-Prot: 62% identical to YLII_ECOLI: Aldose sugar dehydrogenase YliI (yliI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3095)

MetaCyc: 62% identical to aldose sugar dehydrogenase YliI (Escherichia coli K-12 substr. MG1655)
1.1.5.-

Predicted SEED Role

"Soluble aldose sugar dehydrogenase, PQQ-dependent (EC 1.1.5.-)" (EC 1.1.5.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YWP3 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Pf6N2E2_801 Soluble aldose sugar dehydrogenase, PQQ-dependent (EC 1.1.5.-) (Pseudomonas fluorescens FW300-N2E2)
MLRKTLLAAFCASAVLALATPANAAPTQSFKSEEGTLEVTTVVKGLEHPWSVAFLPGQQG
MLVTERPGNLRVVSADGQLSAPLSGVPEVWAKGQGGLLDVVLSPDFKQDRTVYLSYAEAG
ADGKAGTAVGRGQLSEDLKSLKNFDVIFRQLPKLSTGNHFGSRLVFDRDGYLFITLGENN
ERPTAQDLDKLQGKIVRIYPDGKVPDDNPFVGQKNVRPEIWSYGMRNPQGAALNPWNGTL
WENEHGPKGGDEMNIIERGKNYGWPLATHGINYSGAPIPEAQGKTVEGGLDPHHVWQVSP
GLSGMAFYDHGRFKAWQHNVFIGALVPGELIRLQLQDDKIVHEERLLGELKARIRDVRQG
PDGYLYVLTDEDDGALYKVGLK