Protein Info for Pf6N2E2_8 in Pseudomonas fluorescens FW300-N2E2

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 824 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF07660: STN" amino acids 69 to 116 (48 residues), 36.4 bits, see alignment 5.4e-13 PF07715: Plug" amino acids 160 to 262 (103 residues), 62.4 bits, see alignment E=8e-21 TIGR01783: TonB-dependent siderophore receptor" amino acids 162 to 820 (659 residues), 353.5 bits, see alignment E=1.4e-109 PF00593: TonB_dep_Rec_b-barrel" amino acids 348 to 789 (442 residues), 180.8 bits, see alignment E=1.4e-56

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 91% identity to pba:PSEBR_a3917)

Predicted SEED Role

"TonB-dependent siderophore receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YGG9 at UniProt or InterPro

Protein Sequence (824 amino acids)

>Pf6N2E2_8 TonB-dependent siderophore receptor (Pseudomonas fluorescens FW300-N2E2)
MSSIHELKPLFKALVMSRGLRSRRVLAGLGLVCVLPLSAQVMAEDVSINIPAQSLPQALQ
AFGQQTNQQVIYNAADMADLKSTRVSGKMSPQAAIAELLKGTGVRYSLEGNTLMLMRGPA
TGGLELGATTVKATALDATTEGSQAYTSNAVTIGKGTHTLKEIPQSITVMTRKQMDDQNL
VSLKDAVNQTTGIVGLQGVGQGMILSSRGFQIDDWQYDGVPILRNNYSLGNWATQDLIFF
DRLEIMRGAAGLLQGTGSPGGAVNLVRKRGQSAPTVTLTGKAGSWDHYGLQLDAGGPLND
AGNIRGRIVADEDQSNSFVDHAWSKTHSLYGALDIDLSEDTTLGFAVSQSNGESRGNIRG
LPRYADGSMPDVSRSTYTGARWNRSDIDVTTYYTDLEHRFNEDWALKVGAVYMTEDNQAK
NQRTQNGGVGLNPDGTGVQYADFVTDFQSTKSGLDMNLNGKFEALSMEQEVMLGGNFSQL
ETDDKFARTFNNSSSDTIFDLNNNRPDISYDGLINSPGGRGTLSKYDIRQKGVYGTWRVK
PVDDLTLVLGSRVSWYDFSYKSKTETAANGITPNAPSTGTETGVVTPYAGIIYDLSREWA
VYASYTDVFQPQTEVDPSGSVLKPIVGTNYEVGLKGELMDGRVNTSLAVFRYDHENRAVS
IDGCTDVNCSSASGKVRSQGIDAEISGEVVDNLQLFAGYTYNTTKYLEDPDNEGKVFSTW
TPKHMLRVWGNYQFTGDWSRVSTGLGFTTQSHTMVYDYDREIPGYTVWNARVGYQLTPEI
ALAVNANNLFDKTYLTSAYNQLNGNNNFGDPRNLMFTVKYTPQF