Protein Info for Pf6N2E2_772 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details PF08269: dCache_2" amino acids 36 to 192 (157 residues), 144.7 bits, see alignment E=8.9e-46 PF17200: sCache_2" amino acids 42 to 190 (149 residues), 137.7 bits, see alignment E=7.9e-44 PF17201: Cache_3-Cache_2" amino acids 74 to 186 (113 residues), 39.8 bits, see alignment E=8.8e-14 PF00672: HAMP" amino acids 210 to 264 (55 residues), 47.2 bits, see alignment 5.5e-16 PF00015: MCPsignal" amino acids 330 to 509 (180 residues), 140.4 bits, see alignment E=1.4e-44

Best Hits

Swiss-Prot: 70% identical to MCPP_PSEPK: Methyl-accepting chemotaxis protein McpP (mcpP) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 98% identity to pba:PSEBR_a3108)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZU67 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Pf6N2E2_772 Methyl-accepting chemotaxis protein I (serine chemoreceptor protein) (Pseudomonas fluorescens FW300-N2E2)
MNSLRSVSISRRLWLILVVSIVMLFTLGALMLKQIHSDLYQAKVQKTQHVVQTASGVLTY
YQGLEAAGTLTRDAAQKQALSAVRGLRYNQTDYFWINDLTPVMIMHPTNPKLEGQNLSAI
RDPNGYALFNEMVAIAKSKGAGMINYLWPKPGAEAPVGKTSYVQLFEPWGWIIGSGVYVD
DVQAEFQSQVIKASVVGLVITLLMGLLLTLIVRSIVGPLQETVNAMANIASGESDLTRTL
DTHGQDEVTQLARHFNAFTAKLRQVVTQLQASASALGQSSSELGNDAAQAQERSQQQSQQ
MELVATAINEVTYGVQDVAKNAEHAANEMRDAESQAQQGQVNIDGSLQQIDRLSQTIDQA
VEVIRTLASESTQIGSVLEVIRSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRLLA
QRTQKSTAEIQAMIERLQTHSEAAVKVIGDSSRASQLTIEQAGLAGASLNAIGQALRNLN
SLNASIASATLQQAHVVEDINQNVTQAAGLSHSTAMAAEQSSQASTRLKALSEQLNGLLT
QFRV