Protein Info for Pf6N2E2_770 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribosylnicotinamide kinase (EC 2.7.1.22)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13521: AAA_28
  • amino acids 4 to 160 (157 residues), 120 bits, E=6.5e-39

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a3110)

Predicted SEED Role

"Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or PnuC-like transporters (EC 2.7.1.22)

MetaCyc Pathways

• NAD salvage pathway IV (from nicotinamide riboside) (1/2 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.22

Sequence Analysis Tools

See A0A161H4N8 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Pf6N2E2_770 Ribosylnicotinamide kinase (EC 2.7.1.22) (Pseudomonas fluorescens FW300-N2E2)
MKVVVLTGPESSGKSWLAAQLQEHFGGVRVDEYVRHFMEQTQRDTCLADITDIASGQLAW
EDEARARRPALLILDTHLLSNILWSQTLFGDCPDWLEPALLARHYDLHLLLSPEQVEWTG
DGLRCQPELAERMDFFEAIERWLVRHQRHFQVIEGDWTQRRDQVFAAVTRLLEI