Protein Info for Pf6N2E2_760 in Pseudomonas fluorescens FW300-N2E2

Annotation: Na+/H+ antiporter NhaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 43 to 81 (39 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 454 to 472 (19 residues), see Phobius details amino acids 478 to 498 (21 residues), see Phobius details PF06450: NhaB" amino acids 2 to 498 (497 residues), 763.8 bits, see alignment E=1e-233 PF03600: CitMHS" amino acids 71 to 329 (259 residues), 60.3 bits, see alignment E=1.8e-20

Best Hits

Swiss-Prot: 90% identical to NHAB_PSEPF: Na(+)/H(+) antiporter NhaB (nhaB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03314, Na+:H+ antiporter, NhaB family (inferred from 98% identity to pba:PSEBR_a3120)

MetaCyc: 62% identical to Na+:H+ antiporter NhaB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-130

Predicted SEED Role

"Na+/H+ antiporter NhaB" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVS7 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Pf6N2E2_760 Na+/H+ antiporter NhaB (Pseudomonas fluorescens FW300-N2E2)
MSGSMAQAFAHNFLGHSPRWYKACVITFLILNAVVLWTLGPVVAGWMLVVEFIFTLAMAL
KCYPLMPGGLLLVEALVMGMTTPKALYDELLHNFPVILLLMFMVAGIYFMKDLLLFLFSR
LLLGVRSKALLSLMFCFLSAFLSAFLDALTVTAVIISAAVGFYAVYHRVASGNDPRQDSN
VDEDHDLPSSHHEDLNQFRAFLRSLLMHGAVGTALGGVCTLVGEPQNLLIGHEMGWHFAD
FFVKVAPVSLPVLVAGLLTCVALEKLRWFGYGTLLPDNVRTVLADYAEQDNRERTARQRA
ALIVQGIAALILIVGLALHIAEVGLIGLMVIVLITAFTGITDEHRLGNAFKDAMPFTALL
VVFFAVVAVIHDQQLFTPLIQWVLALPADQQPGMLFIANGLLSAISDNVFVATIYITEVK
QAFVSGHMSREQFETLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLSYGRMVWM
ALPYTVVMGGLGWYAVTYWL