Protein Info for Pf6N2E2_732 in Pseudomonas fluorescens FW300-N2E2

Annotation: Respiratory nitrate reductase gamma chain (EC 1.7.99.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details TIGR00351: respiratory nitrate reductase, gamma subunit" amino acids 5 to 225 (221 residues), 275.2 bits, see alignment E=2.4e-86 PF02665: Nitrate_red_gam" amino acids 6 to 225 (220 residues), 256.3 bits, see alignment E=1.2e-80

Best Hits

KEGG orthology group: K00374, nitrate reductase 1, gamma subunit [EC: 1.7.99.4] (inferred from 100% identity to pba:PSEBR_a3145)

MetaCyc: 74% identical to respiratory nitrate reductase gamma subunit (Stutzerimonas stutzeri)
RXN-11236 [EC: 1.7.5.1]

Predicted SEED Role

"Respiratory nitrate reductase gamma chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.5.1 or 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVW8 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Pf6N2E2_732 Respiratory nitrate reductase gamma chain (EC 1.7.99.4) (Pseudomonas fluorescens FW300-N2E2)
MSKWDLLLFGVYPYVALAICLLGSWARFDLSQYTWKAGSSQMLNKRGMRVASNLFHIGVL
FVLAGHFVGLLTPSAIYHHVLSTENKQLLAMVSGGFFGVLGLIGLVMLLNRRLTDPRVRA
TSNASDILVLVVLLVQLVLGLMTIVASTAHMDGSVMVMLADWAQNTVLLRPVEAATSIAP
VGLVYKLHVVLGLTLFVLFPFTRLVHIVSAPVWYLGRRYQIVRQKF