Protein Info for Pf6N2E2_720 in Pseudomonas fluorescens FW300-N2E2

Annotation: Molybdopterin biosynthesis protein MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF03453: MoeA_N" amino acids 12 to 172 (161 residues), 152.2 bits, see alignment E=1.5e-48 TIGR00177: molybdenum cofactor synthesis domain" amino acids 182 to 318 (137 residues), 92.6 bits, see alignment E=1.1e-30 PF00994: MoCF_biosynth" amino acids 186 to 320 (135 residues), 103.8 bits, see alignment E=1e-33 PF03454: MoeA_C" amino acids 336 to 405 (70 residues), 38.6 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 98% identity to pba:PSEBR_c2g63)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTG2 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Pf6N2E2_720 Molybdopterin biosynthesis protein MoeA (Pseudomonas fluorescens FW300-N2E2)
VSGKVCDSGVLMPVDEAIRHLLDQAPPPPPVQRVGLDQALARVLVADILCPMNLPAWDNS
AMDGYALRAADLPGDGGYLLLGGRIAAGDEPGEPLQVGHVVRIFTGAPLPPGADTVVPQE
SCRVDGERVWLPSVNGGDHVRKEGEELRRGDRLLEAGTRLRAQELGLLAGAGVGQVDVYR
PLQVGLLSSGDELREPGEPLAPGQIYNSNRHSLAALLRGWGVEVHDFGVMPDQLLASRQA
LRLAAAECDVLITSGGVSVGEEDHLKQAIEALGSIDLWRLAIQPGKPLAFGDVEGKPWIG
LPGNPSAALITALIVVRPFLFRAQGMRDVLPVPLQLPAGFDWLKRNRRRQYLRARLVPDA
NGHLCVELHPQQSSAMLTAACWADGLAVVECEAQLHKHDKVLYLPFAELMH