Protein Info for Pf6N2E2_706 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitric oxide reductase activation protein NorQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00158: Sigma54_activat" amino acids 24 to 118 (95 residues), 21.3 bits, see alignment E=3.9e-08 PF07728: AAA_5" amino acids 34 to 168 (135 residues), 125.9 bits, see alignment E=2.3e-40 PF08406: CbbQ_C" amino acids 181 to 264 (84 residues), 104 bits, see alignment E=8e-34

Best Hits

Swiss-Prot: 87% identical to NIRQ_PSEST: Denitrification regulatory protein NirQ (nirQ) from Pseudomonas stutzeri

KEGG orthology group: K04748, nitric oxide reductase NorQ protein (inferred from 100% identity to pba:PSEBR_a3171)

Predicted SEED Role

"Nitric oxide reductase activation protein NorQ" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9F0X0 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Pf6N2E2_706 Nitric oxide reductase activation protein NorQ (Pseudomonas fluorescens FW300-N2E2)
MNAIHTLQHPDEPFYQPQDNEQAMFEQAWHHGMPVLIKGPTGCGKTRFVQHMAHRLKLPL
YTVACHDDLSAADLVGRHLIGAQGTWWQDGPLTRAVREGGICYLDEVVEARQDTAVVLHP
LADDRRQLYLERTGEVLQAPPSFMLVVSYNPGYQNLLKGMKPSTRQRFVAMRFGYPAVAD
EERIVAREAGVDLALAAQVVRLGQALRRLDQHDLEEVASTRLLIFAARMIGSGMDPRQAC
LACLAEPLSDDPQTVAALMDVVDVHFG