Protein Info for Pf6N2E2_702 in Pseudomonas fluorescens FW300-N2E2

Annotation: Heme d1 biosynthesis protein NirF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02239: Cytochrom_D1" amino acids 25 to 386 (362 residues), 448.1 bits, see alignment E=8.6e-139

Best Hits

Swiss-Prot: 76% identical to NIRF_PSEAE: Protein NirF (nirF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3175)

Predicted SEED Role

"Heme d1 biosynthesis protein NirF" in subsystem Dissimilatory nitrite reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVU6 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Pf6N2E2_702 Heme d1 biosynthesis protein NirF (Pseudomonas fluorescens FW300-N2E2)
MIRSVLSSTAIALLLCGCAQTPLRGTGDLGVVVERATGSLQIIESDTRTALGRVEGLGDL
SHASVVFSRDQRYAYVFGRDGGLSKVDLLSARIERRIIQGGNSIGGAISQDGKLIAVSNY
EPGGVKVFDARTLEQVADIPATPLPGGQKRSRVVGLVDAPGQRFVFSLFDTGEIWTADFS
QGLTPRIERFTAIGQQPYDALITPDGRYYMAGLFGEDGMAQLDLWHPELGVKRVLGHYGR
GQERLPVYKMPHLEGWAMADQQAFVPAVGHHQVLVMNAQDWQQTDAIAVAGQPVFVTARP
DGRQLWVNFAYPDNDRVQVIDTQTHAIVADLRPGPAVLHMEFTARGDQLWLSARDGGEVQ
VWNPYRLERLSSLPALSPSGIFFSSRAHKPGY