Protein Info for Pf6N2E2_685 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferrichrome-iron receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07715: Plug" amino acids 70 to 168 (99 residues), 81.2 bits, see alignment E=7.9e-27 TIGR01783: TonB-dependent siderophore receptor" amino acids 71 to 707 (637 residues), 360.2 bits, see alignment E=1.3e-111 PF00593: TonB_dep_Rec" amino acids 241 to 678 (438 residues), 241.7 bits, see alignment E=3e-75

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 92% identity to pba:PSEBR_a3192)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVM6 at UniProt or InterPro

Protein Sequence (709 amino acids)

>Pf6N2E2_685 Ferrichrome-iron receptor (Pseudomonas fluorescens FW300-N2E2)
MRRILVSLCVLQAYSVSTWAEQPVPAKPASLELQATDIVGSADYESAQGPVKGYHATRSA
SATRTDTAIHETPQSISVVSRDVVEDLGATRLQDALDYAGGVGRGNNFGGQGLTTFTVRG
FTTGEFYRNGFPINRGYPNMPDANTIERLEVLRGPATMLYGRGDPGGTFNVVSKQPLAER
TVTLGSQVSDQGMRRGTLDASGPLDEEGRLAYRLNVIGEGGDTFRDHVETERYGVAPVVS
WQVNDTTRLTFEGDFMRNNAPLDRGLTHYAGQRGTASRDTFFGEKDVGKLHNDNNMLQVR
FEHMLNDDWTLAGGTQWLDGTLQGNAIEGNGIAADGRTLGRNFNYRKLEWTDRDTQLNLT
GHFSTGGFEHTLLTGIEYEDYDYQSIIQRSSGAVGAYPIDIFDPVYGQPRPALTRKPTDD
QENLKTFGVFVQDQVTLTERLKLLAGARFERFEHKYENFATANGDWDASHNAVTPRLGVI
YDLTDTVAVYANTARSFKPNTGRNAQGGGFKPEEGKSYEMGIKWEALDRQVSVDAAVYQI
EKRNVLTSDPQDSTLNVAAGEVRSRGFDLNVAGNLTPEWRVIGGYAYVDAEVVKDNTFEK
GSRLLNVPRNSFSLLNVYEFQDGGLKGLGLGLGARYVDERAGKMGVNPFSMDSYTVVDLL
GYYKVNERIRLNLDLKNLFDADYEEGAFGGVYAYPGAPRTVQAGISYTL