Protein Info for Pf6N2E2_677 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF08448: PAS_4" amino acids 28 to 136 (109 residues), 66.4 bits, see alignment E=3.9e-22 PF12833: HTH_18" amino acids 169 to 246 (78 residues), 85.9 bits, see alignment E=2.8e-28 PF00165: HTH_AraC" amino acids 209 to 245 (37 residues), 35.1 bits, see alignment 1.6e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3200)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTD4 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Pf6N2E2_677 Transcriptional regulator, AraC family (Pseudomonas fluorescens FW300-N2E2)
MYPSLTPFAPCDLDTLLRSLQPIAPLLDTLADVVFFIKDKQARYAFVNQTLARRCGFKHS
GDLLGLTAEQVFPERFGPLYTEQDRRVLASGRELADQLELHLYYGNQPVWCLTHKLALHD
PNGQIVGLAGISRDLQLPQSGHPAFHKLAAVDAHIKQHFARPISLAELTAIAELSVAQLE
RHCKRIFQLTPRQMIHKARLEEASRLLLDKDLPITEIALRCGYTDHSAFSRQFRALTSLS
PSQYRENQR