Protein Info for Pf6N2E2_664 in Pseudomonas fluorescens FW300-N2E2

Annotation: Acetoin catabolism protein X

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01513: NAD_kinase" amino acids 8 to 161 (154 residues), 51.4 bits, see alignment E=1.4e-17 PF00781: DAGK_cat" amino acids 87 to 145 (59 residues), 28.1 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 48% identical to ACOX_CUPNH: Acetoin catabolism protein X (acoX) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3213)

Predicted SEED Role

"Acetoin catabolism protein X" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YVS1 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Pf6N2E2_664 Acetoin catabolism protein X (Pseudomonas fluorescens FW300-N2E2)
MSRRPLTVGIIANPASGRDVRRLTANAGLFSSTDKVSVIQRLLAAFGATGVEQVLMPTDM
IGMAAAVLKNSHSRQARSSHWPALEFLDLTLRQTVEDTRRAARLMAEREVALIAVLGGDG
THKAVAAEVGDIPLLTLSTGTNNAFPELREATSAGLAGGLYASGRIPDSIGLRRNKRLLV
CDAGRGLREVALVDVAVSPLRFVGARAISRAQDLAEVFVTFAEPQSIGLSALCGLWFPVS
RQAPGGAWMRLDPQSPEALLVPLAPGLLQGCGVLAAGSLEPGVAHGLSLSSGTLALDGER
EIEFNAQDRPTVTLDAGGPLSIDVNAVLAYAAQHRLLAIGREHPQHPLNLQEDTPGE