Protein Info for Pf6N2E2_661 in Pseudomonas fluorescens FW300-N2E2

Annotation: DipZ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 114 to 142 (29 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details PF02683: DsbD" amino acids 5 to 197 (193 residues), 42.5 bits, see alignment E=1.4e-14 PF00578: AhpC-TSA" amino acids 273 to 377 (105 residues), 49.2 bits, see alignment E=1e-16 PF08534: Redoxin" amino acids 273 to 386 (114 residues), 45.6 bits, see alignment E=1.3e-15 PF13905: Thioredoxin_8" amino acids 280 to 375 (96 residues), 40 bits, see alignment E=8.7e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3216)

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTG1 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Pf6N2E2_661 DipZ protein (Pseudomonas fluorescens FW300-N2E2)
MLLIAFLGGILTILSPCILPVVPFLFARADRSRGSVLLTLGGMVLTFALVSSLAVVSSEW
VLRASSVGRQVALVVMVVFALSLIFSRVGTWLARPLVSLGNRLDAGAGRMAGPVASVLIG
VATGLLWAPCAGPILGVILTGAMLQGASAQTSLLLLAYGLGSALSLGTLILAGRGLVGRL
KLSLPITTWLRRGTGAVVLLAAVAIGTGADDRLLAATSSQQSVTLEKSLLENVPKAIDYV
VSKAGASSMPALESQGAMPALDGAVQWLNSPPLSSESLKGKVVLVDFWTYDCINCQHTLP
YVNGWAKKYEKDGLVVIGVHTPEYGYEKIIDNVREQVRKLDIHYPVAIDNQYAIWRAFNN
QYWPAHYFIDAKGQVRYSHFGEGRYGEQEQVIQQLLQEAKAGQ