Protein Info for Pf6N2E2_65 in Pseudomonas fluorescens FW300-N2E2

Annotation: SAM-dependent methyltransferase YafE (UbiE paralog)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF13489: Methyltransf_23" amino acids 36 to 191 (156 residues), 58.2 bits, see alignment E=3.5e-19 PF01209: Ubie_methyltran" amino acids 39 to 158 (120 residues), 66.3 bits, see alignment E=1.1e-21 PF03141: Methyltransf_29" amino acids 43 to 142 (100 residues), 26.4 bits, see alignment E=1.1e-09 PF13847: Methyltransf_31" amino acids 45 to 148 (104 residues), 70.9 bits, see alignment E=4.3e-23 PF03848: TehB" amino acids 46 to 117 (72 residues), 21.2 bits, see alignment E=6.9e-08 PF13649: Methyltransf_25" amino acids 48 to 141 (94 residues), 86.7 bits, see alignment E=5.9e-28 PF08241: Methyltransf_11" amino acids 49 to 145 (97 residues), 93.4 bits, see alignment E=4.3e-30 PF08242: Methyltransf_12" amino acids 49 to 142 (94 residues), 59.1 bits, see alignment E=2.4e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3866)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YI33 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Pf6N2E2_65 SAM-dependent methyltransferase YafE (UbiE paralog) (Pseudomonas fluorescens FW300-N2E2)
MTSTAHSQVVQKQFGEQASAYLSSAVHAQGAEFALLQAALAGRGDARVLDLGCGAGHVSF
HVAPLAGEVVAYDLSQQMLDVVATAAAERGLGNIGTVCGAAEHLPFADAEFDFVFSRYSA
HHWSDLGLALREVRRVLKPGGVAAFIDVLSPGAPLLDTYLQSVEVLRDTSHVRDYSAGEW
LRQVSEAGLHTRSTSRQRLRLEYRSWVERMRTPEVMRAAILELQRSMGDEVREYFQIEAD
GSFSTDVLVLWAER