Protein Info for Pf6N2E2_631 in Pseudomonas fluorescens FW300-N2E2

Annotation: 2-ketogluconate utilization repressor PtxS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00356: LacI" amino acids 13 to 59 (47 residues), 52.9 bits, see alignment 3.7e-18 PF00532: Peripla_BP_1" amino acids 72 to 312 (241 residues), 64.5 bits, see alignment E=1.7e-21 PF13377: Peripla_BP_3" amino acids 179 to 336 (158 residues), 67.5 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a3248)

Predicted SEED Role

"2-ketogluconate utilization repressor PtxS" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTR4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Pf6N2E2_631 2-ketogluconate utilization repressor PtxS (Pseudomonas fluorescens FW300-N2E2)
VTSFSAAQRNRVTMLDVAERAGVSKASVSRFIGEDRALLSEAIARRIEQAISELGYRPNQ
MARGLKRGRTRLIGMLVADIRNPYSIAVMHGVETACRRHGYSLVVCNTDRDDEQERQHLA
LLRAYNIEGLIVNTLGHHREELLELRGEMPLVLVDRKVDRLDSDLVGLDNPAAVAMALDH
LEQRGYRDLLLVTEPFDGTSSRIERVDSFKAGIERRPALTGAVVETCDRLTARIKTFLAQ
PGAGPKALFCANGIAALAATQTLRDLGCHLFDDVGLIALDDLDWYPLVGSGITALAQPTA
EIGASAFECLLKRLRGDNGPVRTLDFAARLIERGSTLGVSR