Protein Info for Pf6N2E2_624 in Pseudomonas fluorescens FW300-N2E2

Annotation: hypothetical protein PA3071

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 111 to 124 (14 residues), see Phobius details PF01882: DUF58" amino acids 57 to 275 (219 residues), 133.8 bits, see alignment E=2.8e-43

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3253)

Predicted SEED Role

"hypothetical protein PA3071"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZT91 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Pf6N2E2_624 hypothetical protein PA3071 (Pseudomonas fluorescens FW300-N2E2)
MNNPLAPAPGIRVSLSELIEMRHRVREVQLFSTPGQRSPLIGLHHSKLRGRGVDFDQVRV
YQAGDDVRTIDWRVTARTQEPHTKLFHEERERPIFIMIEQSHRLFFGSGLVFKSVLAAQA
ASLIGWAALGHNDRVGGLVFGNNTHYEVKPRRSKQSLLQLLNRLVRVNQSLHTEAEPDRD
SFGIALRRAREVLRPGSLAIVICDERALSDSAEQQLSLLSRHCDLLLLPLSDPLDHALPA
AGLLRFTQRGSQLELDTLNFELRQAYRAQAEARQERWEMLAQKLRILMLPLSTQGDMVEQ
LRDYLNPKRAGKSR