Protein Info for Pf6N2E2_617 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF02798: GST_N" amino acids 4 to 69 (66 residues), 41 bits, see alignment E=6.9e-14 PF00462: Glutaredoxin" amino acids 5 to 62 (58 residues), 32.9 bits, see alignment E=2.2e-11 PF13417: GST_N_3" amino acids 6 to 77 (72 residues), 65.6 bits, see alignment E=1.5e-21 PF13409: GST_N_2" amino acids 12 to 71 (60 residues), 56.6 bits, see alignment E=1.2e-18 PF00043: GST_C" amino acids 101 to 192 (92 residues), 37.8 bits, see alignment E=6.5e-13 PF14497: GST_C_3" amino acids 118 to 190 (73 residues), 29.5 bits, see alignment E=2.5e-10 PF13410: GST_C_2" amino acids 132 to 187 (56 residues), 42.7 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a3260)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YVE1 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Pf6N2E2_617 Probable glutathione S-transferase (Pseudomonas fluorescens FW300-N2E2)
MSHATLYSFRRCPYAMRARMALRYSAVEVAIVEVSLKAKPAEMLALSSKGTVPVLQVDGR
VIDESLEIMAWALARHDPQDWRLLDDPEGQTLAAALIEENDHRFKLHLNRYKYPERHPEQ
PVEHYRAEGEVFLGRLETLLEARPFLVADHLSLADVALMPFVRQFAHVDREWFTQAPYPR
LRDWLQRFLASELFVAIMAK