Protein Info for Pf6N2E2_6090 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 108 to 124 (17 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 6 to 179 (174 residues), 68.1 bits, see alignment E=1.2e-22 PF12833: HTH_18" amino acids 239 to 318 (80 residues), 76.1 bits, see alignment E=3.2e-25 PF00165: HTH_AraC" amino acids 280 to 316 (37 residues), 32.1 bits, see alignment 1.5e-11

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3930)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZUG0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Pf6N2E2_6090 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain (Pseudomonas fluorescens FW300-N2E2)
MPNPPKTVHVLAFANVQVLDVTGPLQVFASANDLARQQGLPLPYTPTVIAVGGGAVMSSA
GLALMAEPLPSEGSDTLLIAGGWGVYEAAKDPALVAWVKEHGLRSRRVASVCTGAFLLAA
SGWLDGRRVVTHWTRCEQLAEQHPQLRVEPNPIFINDGPVWTSAGVTAGIDLALALVEED
LGRAVALEVARHLVVFLKRPGGQSQFSVTLSLQKQGSRFDDLHAWIAENLTRDLGLSSLA
AEVGMSERSFVRHYRADTGQTPARAVELIRVETARRLLSDTAVSIKRVAVQCGFGSEETL
RRSFLRAMGVTPQAYRERFAVSPQADPAMP