Protein Info for Pf6N2E2_6074 in Pseudomonas fluorescens FW300-N2E2

Annotation: Redox-sensitive transcriptional activator SoxR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR01950: redox-sensitive transcriptional activator SoxR" amino acids 9 to 149 (141 residues), 229 bits, see alignment E=7.8e-73 PF13411: MerR_1" amino acids 11 to 77 (67 residues), 56.5 bits, see alignment E=3.6e-19 PF00376: MerR" amino acids 11 to 47 (37 residues), 47.6 bits, see alignment E=1.7e-16 PF09278: MerR-DNA-bind" amino acids 52 to 117 (66 residues), 69.9 bits, see alignment E=3.4e-23

Best Hits

Swiss-Prot: 68% identical to SOXR_PSEAE: Redox-sensitive transcriptional activator SoxR (soxR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13639, MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR (inferred from 96% identity to pba:PSEBR_a3946)

Predicted SEED Role

"Redox-sensitive transcriptional activator SoxR" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZU84 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Pf6N2E2_6074 Redox-sensitive transcriptional activator SoxR (Pseudomonas fluorescens FW300-N2E2)
MTQIDIHKELTVGQVAARSGVAVTALHFYESKGLIKSTRNQGNQRRYSRAVLRRVALIKV
AQRLGIPLAEIGEALKSLPDNRAPTAADWQTLSAQWSRDLDERINQLVALRDRLNGCIGC
GCLSMEACPLRNQGDVLGKHGPGAHLLEQP